Recombinant Human Osteoprotegerin/Fc Chimera

Osteoprotegerin (OPG) is a member of the TNFR superfamily that can act as a decoy receptor for RANKL. Binding of soluble OPG to sRANKL inhibits osteoclastogenesis by interrupting the signaling between stromal cells and osteoclastic progenitor cells, thereby leading to excess accumulation of bone and cartilage. OPG is expressed in a wide variety of tissues including adult heart, lung, kidney, liver, spleen, prostate, lymph node and bone marrow. OPG is secreted both as a monomeric and a dimeric protein. Its primary structure consists of seven distinct domains, four of which corresponds to the extracellular cysteine-rich domains of TNFR proteins and constitutes the soluble OPG.

Catalog No.	108-08
Country of Manufacture	China
Product Code	rHuOPG-Fc
Size/Quantity	10µg
Product Use	This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures.
Storage	Store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles.
Shipping Info	Dry ice.
AA Sequence	OPG 22-201: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLY CSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQGTPERNTVCKRC PDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGN SESTQKCGIDVTL Fc232: EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Source	Pichia. Pastoris
Molecular Weight	Recombinant OPG/Fc contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 4
Purity	>90% by SDS-PAGE and HPLC analyses.
Biological Activity	Fully biologically active when compared to the standard. Determined by its ability to neutralize the stimulation of U937 cells treated with 10 ng/ml of soluble RANKL.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Lyophilized from a 0.2m filtered concentrated (0.5mg/ml) solution in PBS, pH 7.4.
Endotoxin	Less than 1EU/g of rHuOPG-Fc as determined by LAL method.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentrat