How can we help you today?
Need help with product selection and ordering?
Email us at sales@sciencellonline.com
Need help with scientific inquiries, technical assistance, product applications, and use?
Email us at techsupport@sciencellonline.com
Need help with issues concerning this website?
Email us at webmaster@sciencellonline.com
Have any marketing related inquiries?
Email us at marketing@sciencellonline.com
Need help ordering from abroad?
As the largest cell provider, we are available worldwide.
Please visit our Distributors page to select the company nearest to your location.
We are located at 1610 Faraday Ave, Carlsbad, CA 92008
Call us at (877) 602-8549 or (760) 602-8549
Fax us at (760) 602-8575
How can we help you today?
Need help with product selection and ordering?
Email us at sales@sciencellonline.com
Need help with scientific inquiries, technical assistance, product applications, and use?
Email us at techsupport@sciencellonline.com
Need help with issues concerning this website?
Email us at webmaster@sciencellonline.com
Have any marketing related inquiries?
Email us at marketing@sciencellonline.com
Need help ordering from abroad?
As the largest cell provider, we are available worldwide.
Please visit our Distributors page to select the company nearest to your location.
We are located at 1610 Faraday Ave, Carlsbad, CA 92008
Call us at (877) 602-8549 or (760) 602-8549
Fax us at (760) 602-8575
There are 0 items in your cart.
Platelet-derived growth factor (PDGF) presenting in serum but absent from plasma was first discovered in animal study by Lynch and co-workers in the late 1980s. It is a disulfide-linked dimer consisting of two peptides-chain A and chain B. PDGF has three subforms: PDGF-AA, PDGF-BB, PDGF-AB. It is involved in a number of biological processes, including hyperplasia, embryonic neuron development, chemotaxis, and respiratory tubule epithelial cell development. The function of PDGF is mediated by two receptors (PDGFR-α and PDGFR-β).
Catalog No. | 105-08 |
---|---|
Country of Manufacture | United States |
Product Code | rhPDGF-AA |
Size/Quantity | 10 μg, 50 μg, or 500 μg |
Product Use | This product is for research use only. It is not approved for human or animal use, or for application in clinical or in vitro diagnostic procedures. |
Storage | Store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles. |
Shipping Info | Gel pack |
Synonyms | Platelet-Derived Growth Factor-AA, Glioma-derived growth factor (GDGF), Osteosarcoma-derived Growth Factor (ODGF) |
AA Sequence | (monomer)
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKR CTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEV QVRLEEHLECACATTSLNPDYREEDTDVR |
Source | Pichia pastoris |
Molecular Weight | Approximately 25 kDa, a disulfide-linked homodimeric protein containing two 110 amino acids residues polypeptide. |
Purity | > 95% by SDS-PAGE |
Physical Appearance | White lyophilized powder. |
Formulation | Lyophilized from a 0.2µm filtered concentrated (1mg/ml) solution in PBS, pH 7.4. |
Endotoxin | <0.1 ng/μg of protein (<1 EU/μg) |
Reconstitution | Reconstitute in sterile distilled water containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
No Publication available at this time
![]() |
We are an expanding biotechnology company whose mission is the research and development of cell and cell-related products for experimental use. About Sciencell