How can we help you today?
Need help with product selection and ordering?
Email us at sales@sciencellonline.com
Need help with scientific inquiries, technical assistance, product applications, and use?
Email us at techsupport@sciencellonline.com
Need help with issues concerning this website?
Email us at webmaster@sciencellonline.com
Have any marketing related inquiries?
Email us at marketing@sciencellonline.com
Need help ordering from abroad?
As the largest cell provider, we are available worldwide.
Please visit our Distributors page to select the company nearest to your location.
We are located at 1610 Faraday Ave, Carlsbad, CA 92008
Call us at (877) 602-8549 or (760) 602-8549
Fax us at (760) 602-8575
How can we help you today?
Need help with product selection and ordering?
Email us at sales@sciencellonline.com
Need help with scientific inquiries, technical assistance, product applications, and use?
Email us at techsupport@sciencellonline.com
Need help with issues concerning this website?
Email us at webmaster@sciencellonline.com
Have any marketing related inquiries?
Email us at marketing@sciencellonline.com
Need help ordering from abroad?
As the largest cell provider, we are available worldwide.
Please visit our Distributors page to select the company nearest to your location.
We are located at 1610 Faraday Ave, Carlsbad, CA 92008
Call us at (877) 602-8549 or (760) 602-8549
Fax us at (760) 602-8575
There are 0 items in your cart.
Catalog No. | 105-01B |
---|---|
Country of Manufacture | United States or China |
Product Code | rhDES1-3/IGF1 |
Size/Quantity | 20μg |
Product Use | This product is for research use only. It is not approved for use in humans, animals, or in vitro diagnostic procedures. |
Storage | Store at -20°C after receiving. Upon reconstitution, store at 2-8°C for up to one week. For maximal stability, aliquot and store at -20°C. Avoid repeated freeze/ thaw cycles. |
Shipping Info | Dry ice. |
AA Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA |
Source | Escherichia coli. |
Molecular Weight | 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acid residues. |
Purity | >97% by SDS-PAGE and HPLC analyses. |
Biological Activity | The ED50 was determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of >5×10^5 IU/mg. |
Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Endotoxin | Less than 1 EU/μg of rHuDES1-3/IGF1 as determined by LAL method. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentratio |
No Publication available at this time
![]() |
We are an expanding biotechnology company whose mission is the research and development of cell and cell-related products for experimental use. About Sciencell